PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART05G01880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 1654aa    MW: 179477 Da    PI: 7.1199
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART05G01880.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.31.5e-07801843347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W +eE e++ +  + +G++ +++I++ ++ ++t  +c+++++k+
  OBART05G01880.1 801 PWIQEEKEIFMEKLATFGKD-FSKISSFLQ-HKTTADCIEFYYKH 843
                      899***************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.77E-13784846IPR009057Homeodomain-like
PROSITE profilePS5129314.547797848IPR017884SANT domain
SMARTSM007174.8E-7798846IPR001005SANT/Myb domain
PfamPF002499.8E-6801843IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-5801845IPR009057Homeodomain-like
PROSITE profilePS5129313.72810061057IPR017884SANT domain
SMARTSM007176.6E-410071055IPR001005SANT/Myb domain
CDDcd001670.0012710111049No hitNo description
SuperFamilySSF466891.48E-810111057IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1654 aa     Download sequence    Send to blast
MPPPPPDRRD FLYRDGRRHD GDPLPPPAPT PPRWRDSPYH PPPPPPPLRD HSRPSPRRTP  60
SSASSGRPFA HKSSDLMLPR PPPPPWTTSP PPLIRRNRSA ISDGYYRQGG GSYDRSYPDE  120
SLGYTPSRSD RYWLDDDGGG GGGGYKGFSR YGGGGGGGSR RDGRDMRGSY RRSPFRGYGS  180
DFSRNHQEHP PPPLRRSPLR SVAVPMSYDP PGDRADRGDR DHHHRVTPWR PLRRRESRSD  240
AADAAGAGPV PVGQAAAAAA SEKDVSARSS AVAAPQVSEE EAPRKKPRLG WGQGLAKYEK  300
QKVQGPAESA EAVAEGSPTA TEQKGITHTP APAPCVSPVA APSPAPCASP VAAPSPAPPC  360
KSPVPEDKSC ELTANTVTES NKNIPGPDVQ ACNNEVPTKL DQLEGDPIDS LAKVLSELVQ  420
HEDSCSGDSK RLSNVSKLLL LKESISKELE KTELEIDSLE GELKSVNVEA RNRTLKDPPT  480
AVTYAQNPSP SPVKEQGELT PSPKISMEQD ADVKGSELME VETAQAHNAK AVSSEESVAC  540
PGVALGQVPA AADVIPSDPC GKTGSGIDVN IEQREENPCQ ENFNAMKADG SSDLATRPCS  600
YREVKYNLMD QIIAANRSEA KKNSQLLFKP VPADRSNLDL LASSYLSSQM KNDVIIKKKH  660
AILKNRQRFK EQILTFKFRV LRHLWKEDVR LLSVRKQRSK SHKRTDQSNR SSQSGSQRQR  720
SSNRSRLAVP AGNLSTFPIT EMSGVARKLF SEFQLKRCRN YLKMPALIVD EKEKAGAKFV  780
SKNGLVEDPV SVEKERALIN PWIQEEKEIF MEKLATFGKD FSKISSFLQH KTTADCIEFY  840
YKHHKSDSFR EVKKLLDLRQ QQQPASNYLG AVSGKKWNPE ANVASLDMLG VATEVAAQGL  900
EYVNEVKKNS AKSILRTVCG VDNSTKGSEK DCVGDVSLHE RESVAADVLA GICGTLSPEG  960
MGSCITSSAD PGQKIGIISR MEHLLTPEAD KNFDDDGTLS DQECEVDIVD WNDDEKSSFI  1020
EAMNRYGKDF ARISSYVKSK SFEQCKVFFS KARKSLGLDL IHQGAADAGF PTGDANGGRS  1080
GTDGACIAEM DSAICSAQSC PKVEIDACPV SDGEIQGHNP LSDIASRQPE ADKSNMPDVV  1140
DINVEEGESK AEKDCSILVD HKQLREDINQ TSCARIDINC PESTDKLQDI EDVTPVNMHG  1200
DDLMATSVEQ VAAAHVESRS SLHSEGIGID VSRIEGCSHE STIGKGGKST PSVCLPAENG  1260
VSKENIIHFK NMDGASSISP AFTSNYQQSK LADPIQSKPK PLTPKDLMPV QFSSSLPDPT  1320
SICFEGIAAI TTPNFEDHGN RASIASGAKD VNMFPTFKDQ SSNRHDALFS NVDGYMQQRR  1380
NNHFGTEVCG LSESTGISQS DQFTVSKFQN GRPSSLGLSN GNLGVLSTGR REEAREGLFR  1440
PCSVKTSAGN EEQQKRPGDV KLFGQILSHQ SSLQSSGSSV HGSKSKPPSP KVDKPASSRL  1500
LSNPRERLVY SSRPPIIANL GLEERAMRSF DHMDGRTIQP EPMVMVAKCQ RPSAGVPVYS  1560
TKNGALSVFA EFQQPSMPPH TSDHKLLENF ADLHKRNGIE LLSGFQQPGR LGGAGVLVSG  1620
VSDPVAALKA QYGSGSKMLS SSNDVDTWKD IGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C5e-16759850494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D5e-16759850494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1297200.0AC129720.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0683F12, complete sequence.
GenBankAC1349310.0AC134931.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0079L11, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639126.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639127.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639128.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639129.10.0PREDICTED: uncharacterized protein LOC9268524
TrEMBLA0A0D3G2S20.0A0A0D3G2S2_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g03550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-76MYB family protein